Recombinant Full Length Human L2HGDH Protein, C-Flag-tagged
Cat.No. : | L2HGDH-727HFL |
Product Overview : | Recombinant Full Length Human L2HGDH Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes L-2-hydroxyglutarate dehydrogenase, a FAD-dependent enzyme that oxidizes L-2-hydroxyglutarate to alpha-ketoglutarate in a variety of mammalian tissues. Mutations in this gene cause L-2-hydroxyglutaric aciduria, a rare autosomal recessive neurometabolic disorder resulting in moderate to severe cognitive disability. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.2 kDa |
AA Sequence : | MVPALRYLVGACGRARGRFAGGSPGACGFASGRPRPLCGGSRSASTSSFDIVIVGGGIVGLASARALILR HPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVA VEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAG GSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVP FRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMD IIINSGLIKLASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFV FDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Butanoate metabolism |
Full Length : | Full L. |
Gene Name | L2HGDH L-2-hydroxyglutarate dehydrogenase [ Homo sapiens (human) ] |
Official Symbol | L2HGDH |
Synonyms | L2HGA; C14orf160 |
Gene ID | 79944 |
mRNA Refseq | NM_024884.3 |
Protein Refseq | NP_079160.1 |
MIM | 609584 |
UniProt ID | Q9H9P8 |
◆ Recombinant Proteins | ||
L2HGDH-615B | Recombinant Bovine L2HGDH Protein (53-463 aa), His-SUMO-tagged | +Inquiry |
L2HGDH-4798H | Recombinant Human L2HGDH protein, His-SUMO-tagged | +Inquiry |
L2HGDH-944H | Recombinant Human L2HGDH | +Inquiry |
L2hgdh-3741M | Recombinant Mouse L2hgdh Protein, Myc/DDK-tagged | +Inquiry |
L2HGDH-727HFL | Recombinant Full Length Human L2HGDH Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
L2HGDH-372HCL | Recombinant Human L2HGDH lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All L2HGDH Products
Required fields are marked with *
My Review for All L2HGDH Products
Required fields are marked with *
0
Inquiry Basket