Recombinant Full Length Human L-Selectin(Sell) Protein, His-Tagged
Cat.No. : | RFL10028HF |
Product Overview : | Recombinant Full Length Human L-selectin(SELL) Protein (P14151) (39-372aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (39-372) |
Form : | Lyophilized powder |
AA Sequence : | WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SELL |
Synonyms | SELL; LNHR; LYAM1; L-selectin; CD62 antigen-like family member L; Leukocyte adhesion molecule 1; LAM-1; Leukocyte surface antigen Leu-8; Leukocyte-endothelial cell adhesion molecule 1; LECAM1; Lymph node homing receptor; TQ1; gp90-MEL; CD antigen CD62L |
UniProt ID | P14151 |
◆ Recombinant Proteins | ||
Sell-682R | Recombinant Rat Sell protein, His-tagged | +Inquiry |
RFL33303MF | Recombinant Full Length Mouse L-Selectin(Sell) Protein, His-Tagged | +Inquiry |
SELL-279H | Recombinant Human L-Selectin,His-tagged | +Inquiry |
SELL-2810H | Recombinant Human SELL protein, His-tagged | +Inquiry |
SELL-7765Z | Recombinant Zebrafish SELL | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELL-1963HCL | Recombinant Human SELL cell lysate | +Inquiry |
SELL-2614MCL | Recombinant Mouse SELL cell lysate | +Inquiry |
SELL-1131CCL | Recombinant Cynomolgus SELL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SELL Products
Required fields are marked with *
My Review for All SELL Products
Required fields are marked with *
0
Inquiry Basket