Recombinant Full Length Human KRTAP8-1 Protein, GST-tagged
Cat.No. : | KRTAP8-1-5832HF |
Product Overview : | Human KRTAP8-1 full-length ORF ( ADR83447.1, 1 a.a. - 63 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 63 amino acids |
Description : | KRTAP8-1 (Keratin Associated Protein 8-1) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. |
Molecular Mass : | 7 kDa |
AA Sequence : | MLCDNFPGAVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGFGYGYNGCGAFGYRRYSPFALY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRTAP8-1 keratin associated protein 8-1 [ Homo sapiens ] |
Official Symbol | KRTAP8-1 |
Synonyms | KAP8.1; KRTAP8-1; keratin associated protein 8-1 |
Gene ID | 337879 |
mRNA Refseq | NM_175857 |
Protein Refseq | NP_787053 |
UniProt ID | Q8IUC2 |
◆ Recombinant Proteins | ||
KRTAP8-1-4802H | Recombinant Human KRTAP8-1 Protein, GST-tagged | +Inquiry |
KRTAP8-1-1591H | Recombinant Human KRTAP8-1 | +Inquiry |
KRTAP8-1-5832HF | Recombinant Full Length Human KRTAP8-1 Protein, GST-tagged | +Inquiry |
KRTAP8-1-3310H | Recombinant Human KRTAP8-1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRTAP8-1-2452R | Recombinant Rhesus monkey KRTAP8-1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRTAP8-1-4839HCL | Recombinant Human KRTAP8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRTAP8-1 Products
Required fields are marked with *
My Review for All KRTAP8-1 Products
Required fields are marked with *
0
Inquiry Basket