Recombinant Full Length Human KRTAP5-8 Protein, GST-tagged

• Cat.No.: KRTAP5-8-5828HF
• Product Overview: Human KRTAP5-8 full-length ORF ( AAI60147.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 187 amino acids
• Description: KRTAP5-8 (Keratin Associated Protein 5-8) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. GO annotations related to this gene include structural constituent of epidermis.
• Molecular Mass: 20.6 kDa
• AA Sequence: MGCCGCSGGCGSGCGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSSCGSCGGSKGGRGSCGGSKGDCGSCGGSKGGCGSCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPCCSQSSCCKPCSCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPCCSQSSCCVPICCQCKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRTAP5-8 keratin associated protein 5-8 [ Homo sapiens (human) ]
• Official Symbol: KRTAP5-8
• Synonyms: KRTAP5-8; keratin associated protein 5-8; UHSKerB; KRTAP5-2; KRTAP5.8; keratin-associated protein 5-8; UHS KERB-like protein; UHS KerB; UHS keratin B; keratin, ultra high-sulfur matrix protein B; keratin, ultrahigh sulfur, B; keratin-associated protein 5.8; ultrahigh sulfur keratin-associated protein 5.8
• Gene ID: 57830
• mRNA Refseq: NM_021046
• Protein Refseq: NP_066384
• UniProt ID: O75690