Recombinant Full Length Human KRTAP3-2 Protein, GST-tagged

Cat.No. : KRTAP3-2-5811HF
Product Overview : Human KRTAP3-2 full-length ORF ( ABM86541.1, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 98 amino acids
Description : This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq
Molecular Mass : 37.18 kDa
AA Sequence : MDCCASRSCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPICCDNCPPPCHIPQPCVPTCFLLNSCQPTPGLETLNLTTFTQPCCEPCLPSTI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTAP3-2 keratin associated protein 3-2 [ Homo sapiens (human) ]
Official Symbol KRTAP3-2
Synonyms KRTAP3-2; keratin associated protein 3-2; KAP3.2; KRTAP3.2; keratin-associated protein 3-2; high sulfur keratin-associated protein 3.2; keratin associated protein 3.2
Gene ID https://www.ncbi.nlm.nih.gov/gene/?term=83897
mRNA Refseq NM_031959
Protein Refseq NP_114165
UniProt ID Q9BYR7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KRTAP3-2 Products

Required fields are marked with *

My Review for All KRTAP3-2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon