Recombinant Full Length Human KRTAP3-2 Protein, GST-tagged

• Cat.No.: KRTAP3-2-5811HF
• Product Overview: Human KRTAP3-2 full-length ORF ( ABM86541.1, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 98 amino acids
• Description: This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq
• Molecular Mass: 37.18 kDa
• AA Sequence: MDCCASRSCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPICCDNCPPPCHIPQPCVPTCFLLNSCQPTPGLETLNLTTFTQPCCEPCLPSTI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRTAP3-2 keratin associated protein 3-2 [ Homo sapiens (human) ]
• Official Symbol: KRTAP3-2
• Synonyms: KRTAP3-2; keratin associated protein 3-2; KAP3.2; KRTAP3.2; keratin-associated protein 3-2; high sulfur keratin-associated protein 3.2; keratin associated protein 3.2
• Gene ID: https://www.ncbi.nlm.nih.gov/gene/?term=83897
• mRNA Refseq: NM_031959
• Protein Refseq: NP_114165
• UniProt ID: Q9BYR7