Recombinant Full Length Human KRTAP19-4 Protein, GST-tagged

Cat.No. : KRTAP19-4-5808HF
Product Overview : Human KRTAP19-4 full-length ORF ( ADR82788.1, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 84 amino acids
Description : KRTAP19-4 (Keratin Associated Protein 19-4) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology.
Molecular Mass : 9.3 kDa
AA Sequence : MSYYGSYYRGLGYGCGGFGGLGYGYGCGCGSFRRLGYGCGFGGNGYGYCRPSCYGGYGFSILLKSYPEDTISEVIRRSFNLTKY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTAP19-4 keratin associated protein 19-4 [ Homo sapiens ]
Official Symbol KRTAP19-4
Synonyms KAP19.4; KRTAP19-4; keratin associated protein 19-4
Gene ID 337971
mRNA Refseq NM_181610
Protein Refseq NP_853641
UniProt ID Q3LI73

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KRTAP19-4 Products

Required fields are marked with *

My Review for All KRTAP19-4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon