Recombinant Full Length Human KRTAP19-4 Protein, GST-tagged

• Cat.No.: KRTAP19-4-5808HF
• Product Overview: Human KRTAP19-4 full-length ORF ( ADR82788.1, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 84 amino acids
• Description: KRTAP19-4 (Keratin Associated Protein 19-4) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology.
• Molecular Mass: 9.3 kDa
• AA Sequence: MSYYGSYYRGLGYGCGGFGGLGYGYGCGCGSFRRLGYGCGFGGNGYGYCRPSCYGGYGFSILLKSYPEDTISEVIRRSFNLTKY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRTAP19-4 keratin associated protein 19-4 [ Homo sapiens ]
• Official Symbol: KRTAP19-4
• Synonyms: KAP19.4; KRTAP19-4; keratin associated protein 19-4
• Gene ID: 337971
• mRNA Refseq: NM_181610
• Protein Refseq: NP_853641
• UniProt ID: Q3LI73