Recombinant Full Length Human KRTAP13-1 Protein, GST-tagged

• Cat.No.: KRTAP13-1-5802HF
• Product Overview: Human KRTAP13-1 full-length ORF ( AAI13539.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Hair keratins and hair keratin-associated proteins (KAPs), such as KRTAP13-1, are the main structural proteins of hair fibers (Rogers et al., 2002 [PubMed 12359730]).[supplied by OMIM
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 47 kDa
• Protein length: 193 amino acids
• AA Sequence: MWHANSESSQCNSAELTSPINMSYNCCSGNFSSRSCGGYLHYPASSCGFSYPSNQVYSTDLCSPSTCQLGSSLYRGCQQTCWEPTSCQTSYVESSPCQTSCYRPRTSLLCSPCQTTYSGSLGFGSSSCRSLGYGSRSCYSVGCGSSGFRSLGYGGCGFPSLGYGVGFCRPTYLASRSCQSSCYRPTCGSGFYY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRTAP13-1 keratin associated protein 13-1 [ Homo sapiens ]
• Official Symbol: KRTAP13-1
• Synonyms: KRTAP13-1; keratin associated protein 13-1; KAP13.1
• Gene ID: 337881
• mRNA Refseq: NM_181599
• Protein Refseq: NP_853630
• MIM: 608718
• UniProt ID: Q8IUC0