Recombinant Full Length Human KRT24 Protein, C-Flag-tagged
Cat.No. : | KRT24-1826HFL |
Product Overview : | Recombinant Full Length Human KRT24 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. The type I keratin genes are clustered in a region of chromosome 17q12-q21. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.9 kDa |
AA Sequence : | MSCSSRASSSRAGGSSSARVSAGGSSFSSGSRCGLGGSSAQGFRGGASSCSLSGGSSGAFGGSFGGGFGS CSVGGGFGGASGSGTGFGGGSSFGGVSGFGRGSGFCGSSRFSSGATGGFYSYGGGMGGGVGDGGLFSGGE KQTMQNLNDRLANYLDKVRALEEANTDLENKIKEWYDKYGPGSGDGGSGRDYSKYYSIIEDLRNQIIAAT VENAGIILHIDNARLAADDFRLKYENELCLRQSVEADINGLRKVLDDLTMTRSDLEMQIESFTEELAYLR KNHEEEMKNMQGSSGGEVTVEMNAAPGTDLTKLLNDMRAQYEELAEQNRREAEERFNKQSASLQAQISTD AGAATSAKNEITELKRTLQALEIELQSQLAMKSSLEGTLADTEAGYVAQLSEIQTQISALEEEICQIWGE TKCQNAEYKQLLDIKTRLEVEIETYRRLLDGEGGGSSFAEFGGRNSGSVNMGSRDLVSGDSRSGSCSGQG RDSSKTRVTKTIVEELVDGKVVSSQVSSISEVKVK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | KRT24 keratin 24 [ Homo sapiens (human) ] |
Official Symbol | KRT24 |
Synonyms | K24; KA24; CK-24 |
Gene ID | 192666 |
mRNA Refseq | NM_019016.3 |
Protein Refseq | NP_061889.2 |
MIM | 607742 |
UniProt ID | Q2M2I5 |
◆ Recombinant Proteins | ||
KRT24-211H | Recombinant Human KRT24 protein, His-tagged | +Inquiry |
KRT24-8827M | Recombinant Mouse KRT24 Protein | +Inquiry |
KRT24-1826HFL | Recombinant Full Length Human KRT24 Protein, C-Flag-tagged | +Inquiry |
KRT24-4861H | Recombinant Human KRT24 Protein, GST-tagged | +Inquiry |
KRT24-5938HF | Recombinant Full Length Human KRT24 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRT24-4872HCL | Recombinant Human KRT24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRT24 Products
Required fields are marked with *
My Review for All KRT24 Products
Required fields are marked with *
0
Inquiry Basket