Recombinant Full Length Human KPNA5 Protein, GST-tagged
Cat.No. : | KPNA5-5819HF |
Product Overview : | Human KPNA5 full-length ORF ( AAH47409.1, 1 a.a. - 539 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 539 amino acids |
Description : | The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus. [provided by RefSeq |
Molecular Mass : | 85.03 kDa |
AA Sequence : | MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KPNA5 karyopherin alpha 5 (importin alpha 6) [ Homo sapiens ] |
Official Symbol | KPNA5 |
Synonyms | KPNA5; karyopherin alpha 5 (importin alpha 6); importin subunit alpha-6; IPOA6; SRP6; importin alpha 6; karyopherin subunit alpha-5; |
Gene ID | 3841 |
mRNA Refseq | NM_002269 |
Protein Refseq | NP_002260 |
MIM | 604545 |
UniProt ID | O15131 |
◆ Recombinant Proteins | ||
KPNA5-274HF | Recombinant Full Length Human KPNA5 Protein | +Inquiry |
KPNA5-3303R | Recombinant Rat KPNA5 Protein | +Inquiry |
KPNA5-2661Z | Recombinant Zebrafish KPNA5 | +Inquiry |
Kpna5-1720R | Recombinant Rat Kpna5 Protein, His-tagged | +Inquiry |
KPNA5-2959R | Recombinant Rat KPNA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KPNA5-4888HCL | Recombinant Human KPNA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KPNA5 Products
Required fields are marked with *
My Review for All KPNA5 Products
Required fields are marked with *
0
Inquiry Basket