Recombinant Full Length Human KLHL41 Protein, C-Flag-tagged
Cat.No. : | KLHL41-1596HFL |
Product Overview : | Recombinant Full Length Human KLHL41 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the kelch-like family. The encoded protein contains a BACK domain, a BTB/POZ domain, and 5 Kelch repeats. This protein is thought to function in skeletal muscle development and maintenance. Mutations in this gene have been associated with nemaline myopathy (NM), a rare congenital muscle disorder. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.9 kDa |
AA Sequence : | MDSQRELAEELRLYQSTLLQDGLKDLLDEKKFIDCTLKAGDKSLPCHRLILSACSPYFREYFLSEIDEAK KKEVVLDNVDPAILDLIIKYLYSASIDLNDGNVQDIFALASRFQIPSVFTVCVSYLQKRLAPGNCLAILR LGLLLDCPRLAISAREFVSDRFVQICKEEDFMQLSPQELISVISNDSLNVEKEEAVFEAVMKWVRTDKEN RVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTGAGEVNG DVGDEDLLPGYLNDIPRHGMFVKDLILLVNDTAAVAYDPTENECYLTALAEQIPRNHSSIVTQQNQIYVV GGLYVDEENKDQPLQSYFFQLDSIASEWVGLPPLPSARCLFGLGEVDDKIYVVAGKDLQTEASLDSVLCY DPVAAKWNEVKKLPIKVYGHNVISHKGMIYCLGGKTDDKKCTNRVFIFNPKKGDWKDLAPMKIPRSMFGV AVHKGKIVIAGGVTEDGLSASVEAFDLTTNKWDVMTEFPQERSSISLVSLAGSLYAIGGFAMIQLESKEF APTEVNDIWKYEDDKKEWAGMLKEIRYASGASCLATRLNLFKLSKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | KLHL41 kelch like family member 41 [ Homo sapiens (human) ] |
Official Symbol | KLHL41 |
Synonyms | Krp1; KBTBD10; SARCOSIN |
Gene ID | 10324 |
mRNA Refseq | NM_006063.3 |
Protein Refseq | NP_006054.2 |
MIM | 607701 |
UniProt ID | O60662 |
◆ Recombinant Proteins | ||
Klhl41-3720M | Recombinant Mouse Klhl41 Protein, Myc/DDK-tagged | +Inquiry |
KLHL41-1596HFL | Recombinant Full Length Human KLHL41 Protein, C-Flag-tagged | +Inquiry |
KLHL41-2318H | Recombinant Human KLHL41 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KLHL41-1256H | Recombinant Human KLHL41 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLHL41-609H | Recombinant Human KLHL41 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLHL41-352HCL | Recombinant Human KLHL41 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLHL41 Products
Required fields are marked with *
My Review for All KLHL41 Products
Required fields are marked with *
0
Inquiry Basket