Recombinant Full Length Human ITIH5 Protein, C-Flag-tagged
Cat.No. : | ITIH5-992HFL |
Product Overview : | Recombinant Full Length Human ITIH5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a heavy chain component of one of the inter-alpha-trypsin inhibitor (ITI) family members. ITI proteins are involved in extracellular matrix stabilization and in the prevention of tumor metastasis. They are also structurally related plasma serine protease inhibitors and are composed of a light chain and varying numbers of heavy chains. This family member is thought to function as a tumor suppressor in breast and thyroid cancers. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 105.9 kDa |
AA Sequence : | MLLLLGLCLGLSLCVGSQEEAQSWGHSSEQDGLRVPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVS CRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEI FRASAVIPSKDKAAFFLSYEELLQRRLGKYEHSISVRPQQLSGRLSVDVNILESAGIASLEVLPLHNSRQ RGSGRGEDDSGPPPSTVINQNETFANIIFKPTVVQQARIAQNGILGDFIIRYDVNREQSIGDIQVLNGYF VHYFAPKDLPPLPKNVVFVLDSSASMVGTKLRQTKDALFTILHDLRPQDRFSIIGFSNRIKVWKDHLISV TPDSIRDGKVYIHHMSPTGGTDINGALQRAIRLLNKYVAHSGIGDRSVSLIVFLTDGKPTVGETHTLKIL NNTREAARGQVCIFTIGIGNDVDFRLLEKLSLENCGLTRRVHEEEDAGSQLIGFYDEIRTPLLSDIRIDY PPSSVVQATKTLFPNYFNGSEIIIAGKLVDRKLDHLHVEVTASNSKKFIILKTDVPVRPQKAGKDVTGSP RPGGDGEGDTNHIERLWSYLTTKELLSSWLQSDDEPEKERLRQRAQALAVSYRFLTPFTSMKLRGPVPRM DGLEEAHGMSAAMGPEPVVQSVRGAGTQPGPLLKKPYQPRIKISKTSVDGDPHFVVDFPLSRLTVCFNID GQPGDILRLVSDHRDSGVTVNGELIGAPAPPNGHKKQRTYLRTITILINKPERSYLEITPSRVILDGGDR LVLPCNQSVVVGSWGLEVSVSANANVTVTIQGSIAFVILIHLYKKPAPFQRHHLGFYIANSEGLSSNCHG LLGQFLNQDARLTEDPAGPSQNLTHPLLLQVGEGPEAVLTVKGHQVPVVWKQRKIYNGEEQIDCWFARNN AAKLIDGEYKDYLASHPFDTGMDTWPGNVQGALKLAALKMQVHEGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ITIH5 inter-alpha-trypsin inhibitor heavy chain 5 [ Homo sapiens (human) ] |
Official Symbol | ITIH5 |
Synonyms | ITI-HC5; PP14776 |
Gene ID | 80760 |
mRNA Refseq | NM_030569.7 |
Protein Refseq | NP_085046.5 |
MIM | 609783 |
UniProt ID | Q86UX2 |
◆ Recombinant Proteins | ||
S100A10-7055C | Recombinant Chicken S100A10 | +Inquiry |
Ripk3-1263R | Recombinant Rat Ripk3 protein, His & T7-tagged | +Inquiry |
HSPA6-5109H | Recombinant Human HSPA6 Protein | +Inquiry |
EIF4A1-0101H | Recombinant Human EIF4A1 Protein (M1-I406), Tag Free | +Inquiry |
CD1C-5519H | Recombinant Human CD1C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
CA2-31M | Native Mouse Carbonic Anhydrase II (CA2) Protein | +Inquiry |
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
IBVF0704-224I | Native Influenza (B/Florida 07/04 ) IBVF0704 protein | +Inquiry |
CTSG-8070H | Native Human Neutrophil Cathepsin G Biotinylated | +Inquiry |
THBD-306R | Active Native Rabbit Lung Thrombomodulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAD1-215HCL | Recombinant Human DAD1 lysate | +Inquiry |
RSBN1L-2135HCL | Recombinant Human RSBN1L 293 Cell Lysate | +Inquiry |
Parietal Lobe-43H | Human Parietal Lobe Tissue Lysate | +Inquiry |
IL17RC-1611HCL | Recombinant Human IL17RC cell lysate | +Inquiry |
DUSP7-516HCL | Recombinant Human DUSP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITIH5 Products
Required fields are marked with *
My Review for All ITIH5 Products
Required fields are marked with *
0
Inquiry Basket