Recombinant Full Length Human ITGA3 Protein, C-Flag-tagged
Cat.No. : | ITGA3-1011HFL |
Product Overview : | Recombinant Full Length Human ITGA3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function as cell surface adhesion molecules. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 3 subunit. This subunit joins with a beta 1 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. Expression of this gene may be correlated with breast cancer metastasis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 115.6 kDa |
AA Sequence : | MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQTERQQRYLL LAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVC AHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTSGGFTQNTV YFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGA VFLLSQEAGGDLRRRQVLEGSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAG TSFPAHPSLLLHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGE KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVPRPAVLDPALCTATSC VQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDN LRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQALENHTEVQFQKECGPDNKCESNLQMRAA FVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETI FCELGNPFKRNQRMELLITFEVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMVNHR LQSFFGGTVMGESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG NGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSETVLTCATGRAH CVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSIPTINMENKTTWFSVDIDS ELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCDFFKRTRYYQIMPKYHAVRIREEERYPPPGSTLP TKKHWVTSWQTRDQYYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hematopoietic cell lineage, Hypertrophic cardiomyopathy (HCM), Pathways in cancer, Regulation of actin cytoskeleton, Small cell lung cancer |
Full Length : | Full L. |
Gene Name | ITGA3 integrin subunit alpha 3 [ Homo sapiens (human) ] |
Official Symbol | ITGA3 |
Synonyms | JEB7; VL3A; CD49C; FRP-2; GAPB3; ILNEB; MSK18; VCA-2; VLA3a; GAP-B3 |
Gene ID | 3675 |
mRNA Refseq | NM_002204.4 |
Protein Refseq | NP_002195.1 |
MIM | 605025 |
UniProt ID | P26006 |
◆ Recombinant Proteins | ||
GRK6-7282M | Recombinant Mouse GRK6 Protein | +Inquiry |
GLRA1-8975Z | Recombinant Zebrafish GLRA1 | +Inquiry |
SNAP29-8516M | Recombinant Mouse SNAP29 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM123-1426C | Recombinant Chicken TMEM123 | +Inquiry |
HA-597V | Recombinant H5N1 HA protein(Met1-Glu340), His-tagged | +Inquiry |
◆ Native Proteins | ||
REN-245H | Active Native Human Renin | +Inquiry |
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
Tenascin-112H | Native Human Tenascin | +Inquiry |
Lectin-1832R | Active Native Ricinus Communis Agglutinin I Protein, Fluorescein labeled | +Inquiry |
IGHE-214H | Native Human Immunoglobulin E (IgE) | +Inquiry |
◆ Cell & Tissue Lysates | ||
MALME-3M-061WCY | Human Melanoma MALME-3M Whole Cell Lysate | +Inquiry |
SERPINA10-2068MCL | Recombinant Mouse SERPINA10 cell lysate | +Inquiry |
NLRX1-3796HCL | Recombinant Human NLRX1 293 Cell Lysate | +Inquiry |
TCP11-1754HCL | Recombinant Human TCP11 cell lysate | +Inquiry |
MTPAP-1280HCL | Recombinant Human MTPAP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGA3 Products
Required fields are marked with *
My Review for All ITGA3 Products
Required fields are marked with *
0
Inquiry Basket