Recombinant Full Length Human ISCA2 Protein, GST-tagged

• Cat.No.: ISCA2-3496HF
• Product Overview: Human HBLD1 full-length ORF ( NP_919255.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 154 amino acids
• Description: The protein encoded by this gene is an A-type iron-sulfur cluster (ISC) protein found in mitochondria. The encoded protein appears to be involved in the maturation of mitochondrial iron-sulfur proteins. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]
• Molecular Mass: 42.8 kDa
• AA Sequence: MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ISCA2 iron-sulfur cluster assembly 2 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ISCA2
• Synonyms: ISCA2; iron-sulfur cluster assembly 2 homolog (S. cerevisiae); HBLD1, HesB like domain containing 1; iron-sulfur cluster assembly 2 homolog, mitochondrial; ISA2; HesB like domain containing 1; HESB-like domain-containing protein 1; HBLD1; c14_5557
• Gene ID: 122961
• mRNA Refseq: NM_194279
• Protein Refseq: NP_919255
• MIM: 615317
• UniProt ID: Q86U28