Recombinant Full Length Human IRF4 Protein, C-Flag-tagged
Cat.No. : | IRF4-404HFL |
Product Overview : | Recombinant Full Length Human IRF4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the IRF (interferon regulatory factor) family of transcription factors, characterized by an unique tryptophan pentad repeat DNA-binding domain. The IRFs are important in the regulation of interferons in response to infection by virus, and in the regulation of interferon-inducible genes. This family member is lymphocyte specific and negatively regulates Toll-like-receptor (TLR) signaling that is central to the activation of innate and adaptive immune systems. A chromosomal translocation involving this gene and the IgH locus, t(6;14)(p25;q32), may be a cause of multiple myeloma. Alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51.6 kDa |
AA Sequence : | MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAAL FKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLT LEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPAC ENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGH TYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKL ERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQN SGHFLRGYDLPEHISNPEDYHRSIRHSSIQETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | IRF4 interferon regulatory factor 4 [ Homo sapiens (human) ] |
Official Symbol | IRF4 |
Synonyms | MUM1; LSIRF; SHEP8; NF-EM5 |
Gene ID | 3662 |
mRNA Refseq | NM_002460.4 |
Protein Refseq | NP_002451.2 |
MIM | 601900 |
UniProt ID | Q15306 |
◆ Recombinant Proteins | ||
IRF4-106H | Recombinant Human IRF4 Protein, N-His tagged | +Inquiry |
IRF4-5872C | Recombinant Chicken IRF4 | +Inquiry |
Irf4-3575M | Recombinant Mouse Irf4 Protein, Myc/DDK-tagged | +Inquiry |
Irf4-1749M | Recombinant Mouse Irf4 protein, His & T7-tagged | +Inquiry |
IRF4-142H | Recombinant Human Human Interferon Regulatory Factor 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF4-5165HCL | Recombinant Human IRF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRF4 Products
Required fields are marked with *
My Review for All IRF4 Products
Required fields are marked with *
0
Inquiry Basket