Recombinant Full Length Human IQCF2 Protein, GST-tagged

• Cat.No.: IQCF2-5711HF
• Product Overview: Human IQCF2 full-length ORF (AAH40047.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 164 amino acids
• Description: IQCF2 (IQ Motif Containing F2) is a Protein Coding gene. An important paralog of this gene is IQCF1.
• Molecular Mass: 44.44 kDa
• AA Sequence: MRVRFCTKGNLILVIIEDVEESIEWKTLQKKKQQKIKEKLRIRTKAAVKIQAWWRGTLVRRTLLHAALRAWIIQCWWRMTLSRVLEKKRQAALIAYATRERAVIKLQSLVRMWRVRWRYCQVLNAIYIIQGHWQCHNCQTCALLQGHCVVTATHLQFHIEIINS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IQCF2 IQ motif containing F2 [ Homo sapiens (human) ]
• Official Symbol: IQCF2
• Synonyms: IQCF2; IQ motif containing F2; IQ domain-containing protein F2
• Gene ID: 389123
• mRNA Refseq: NM_203424
• Protein Refseq: NP_982248
• UniProt ID: Q8IXL9