Recombinant Full Length Human IQCF1 Protein, GST-tagged

• Cat.No.: IQCF1-5709HF
• Product Overview: Human IQCF1 full-length ORF ( NP_689610.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 205 amino acids
• Description: IQCF1 (IQ Motif Containing F1) is a Protein Coding gene. An important paralog of this gene is IQCF5.
• Molecular Mass: 50.1 kDa
• AA Sequence: MEEKQPQKTKEPSKEDEPQQKEMPTHLSLGAESKAEAKTPVLVETQTVDNANEKSEKPPENQKKLSDKDTVATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAFSRKEWAAVTLQSQARMWRIRRRYCQVLNAVRIIQAYWRCRSCASRGFIKGQYRVTANQLHLQLEILLDSGPCIVTECIPFSIKE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IQCF1 IQ motif containing F1 [ Homo sapiens ]
• Official Symbol: IQCF1
• Synonyms: IQCF1; IQ motif containing F1; IQ domain-containing protein F1; MGC39725; FLJ27508
• Gene ID: 132141
• mRNA Refseq: NM_152397
• Protein Refseq: NP_689610
• UniProt ID: Q8N6M8