Recombinant Full Length Human IP6K3 Protein, C-Flag-tagged
Cat.No. : | IP6K3-1906HFL |
Product Overview : | Recombinant Full Length Human IP6K3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. Alternative splicing results in multiple transcript variants encoding the same protein. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.2 kDa |
AA Sequence : | MVVQNSADAGDMRAGVQLEPFLHQVGGHMSVMKYDEHTVCKPLVSREQRFYESLPLAMKRFTPQYKGTVT VHLWKDSTGHLSLVANPVKESQEPFKVSTESAAVAIWQTLQQTTGSNGSDCTLAQWPHAQLARSPKESPA KALLRSEPHLNTPAFSLVEDTNGNQVERKSFNPWGLQCHQAHLTRLCSEYPENKRHRFLLLENVVSQYTH PCVLDLKMGTRQHGDDASEEKKARHMRKCAQSTSACLGVRICGMQVYQTDKKYFLCKDKYYGRKLSVEGF RQALYQFLHNGSHLRRELLEPILHQLRALLSVIRSQSSYRFYSSSLLVIYDGQEPPERAPGSPHPHEAPQ AAHGSSPGGLTKVDIRMIDFAHTTYKGYWNEHTTYDGPDPGYIFGLENLIRILQDIQEGE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | IP6K3 inositol hexakisphosphate kinase 3 [ Homo sapiens (human) ] |
Official Symbol | IP6K3 |
Synonyms | IHPK3; INSP6K3 |
Gene ID | 117283 |
mRNA Refseq | NM_054111.5 |
Protein Refseq | NP_473452.2 |
MIM | 606993 |
UniProt ID | Q96PC2 |
◆ Recombinant Proteins | ||
IP6K3-0442H | Recombinant Human IP6K3 Protein (Met1-Glu410), C-His-tagged | +Inquiry |
IP6K3-339H | Recombinant Human IP6K3 Protein, His-tagged | +Inquiry |
IP6K3-1190H | Recombinant Human IP6K3 Protein, His (Fc)-Avi-tagged | +Inquiry |
IP6K3-1906HFL | Recombinant Full Length Human IP6K3 Protein, C-Flag-tagged | +Inquiry |
IP6K3-8258M | Recombinant Mouse IP6K3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IP6K3-5185HCL | Recombinant Human IP6K3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IP6K3 Products
Required fields are marked with *
My Review for All IP6K3 Products
Required fields are marked with *
0
Inquiry Basket