Recombinant Full Length Human Interferon Alpha-Inducible Protein 27-Like Protein 2(Ifi27L2) Protein, His-Tagged

• Cat.No.: RFL9489HF
• Product Overview: Recombinant Full Length Human Interferon alpha-inducible protein 27-like protein 2(IFI27L2) Protein (Q9H2X8) (25-130aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: Full Length of Mature Protein (25-130)
• Form: Lyophilized powder
• AA Sequence: AMGFTGAGIAASSIAAKMMSAAAIANGGGVSAGSLVATLQSVGAAGLSTSSNILLASVGS VLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPKPPLKSEKHEE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: IFI27L2
• Synonyms: IFI27L2; FAM14A; TLH29; Interferon alpha-inducible protein 27-like protein 2; Interferon-stimulated gene 12b protein; ISG12(b; ISG12B; Protein TLH29; pIFI27-like protein
• UniProt ID: Q9H2X8