Recombinant Full Length Human INPP4B Protein, GST-tagged

• Cat.No.: INPP4B-5895HF
• Product Overview: Human INPP4B full-length ORF ( AAH05273, 1 a.a. - 53 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 53 amino acids
• Description: INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing, as has been established for the type I enzyme. [provided by RefSeq
• Molecular Mass: 31.57 kDa
• AA Sequence: MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: INPP4B inositol polyphosphate-4-phosphatase, type II, 105kDa [ Homo sapiens ]
• Official Symbol: INPP4B
• Synonyms: INPP4B; inositol polyphosphate-4-phosphatase, type II, 105kDa; inositol polyphosphate 4 phosphatase, type II, 105kD; type II inositol 3,4-bisphosphate 4-phosphatase; inositol polyphosphate 4-phosphatase type II; type II inositol-3,4-bisphosphate 4-phosphatase; inositol polyphosphate 4-phosphatase II; 4-phosphatase II; MGC132014
• Gene ID: 8821
• mRNA Refseq: NM_001101669
• Protein Refseq: NP_001095139
• MIM: 607494
• UniProt ID: O15327