Recombinant Full Length Human IMMP1L Protein, GST-tagged

• Cat.No.: IMMP1L-5801HF
• Product Overview: Human IMMP1L full-length ORF ( NP_659418.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 166 amino acids
• Description: The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 and IMP2 (IMMP2L; MIM 605977) are the catalytic subunits of the IMP complex (Burri et al., 2005 [PubMed 15814844]).[supplied by OMIM
• Molecular Mass: 44.9 kDa
• AA Sequence: MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IMMP1L IMP1 inner mitochondrial membrane peptidase-like (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: IMMP1L
• Synonyms: IMP1; IMP1-LIKE; IMMP1L; IMP1 inner mitochondrial membrane peptidase-like (S. cerevisiae)
• Gene ID: 196294
• mRNA Refseq: NM_144981
• Protein Refseq: NP_659418
• MIM: 612323
• UniProt ID: Q96LU5