Recombinant Full Length Human IL18 Protein, C-Flag-tagged

• Cat.No.: IL18-1668HFL
• Product Overview: Recombinant Full Length Human IL18 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The protein encoded by this gene is a proinflammatory cytokine of the IL-1 family that is constitutively found as a precursor within the cytoplasm of a variety of cells including macrophages and keratinocytes. The inactive IL-18 precursor is processed to its active form by caspase-1, and is capable of stimulating interferon gamma production, and of regulating both T helper (Th) 1 and Th2 responses. This cytokine has been implicated in the injury of different organs, and in potentially fatal conditions characterized by a cytokine storm. In humans, IL-18 gene is located on chromosome 11. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 22.1 kDa
• AA Sequence: MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMT DSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQR
  SVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway
• Full Length: Full L.

Gene Information

• Gene Name: IL18 interleukin 18 [ Homo sapiens (human) ]
• Official Symbol: IL18
• Synonyms: IGIF; IL-18; IL-1g; IL1F4
• Gene ID: 3606
• mRNA Refseq: NM_001562.4
• Protein Refseq: NP_001553.1
• MIM: 600953
• UniProt ID: Q14116

Q&As

What are the difference between IL18-01HG, IL18-153HG and IL18-500H. (sequence, biological activity, QC, or what do you propose to buy)

IL18-01HG: Sequence: a.a.37-193 Endotoxin: <20 EU/mg Bio-activity: >5.0 x 10^4 IU/mg QC: Activity test, SDS-PAGE, LAL, SEC-HPLC IL18-153HG: Protein length: Tyr37-Asp193 AA Sequence: YFGKLESKLS VIRNLNDQVL FIDQGNRPLF EDMTDSDCRD NAPRTIFIISMYKDSQPRGM AVTISVKCEK ISTLSCENKI ISFKEMNPPD NIKDTKSDIIFFQRSVPGHD NKMQFESSSY EGYFLACEKE RDLFKLILKK EDELGDRSIMFTVQNEDVD Bio-activity: 1.0*10^6IU Measured by its ability to induce IFN-gamma secretion by KG‐1 human acute myelogenous leukemia cells in the presence of TNF-alpha. QC: Activity test, SDS-PAGE, LAL IL18-500H Recombinant Human IL18 will be custom produced upon order. All the sequence, purity, activity, and QC procedures will be optional and decided by our customer.