Recombinant Full Length Human IGIP Protein, GST-tagged

• Cat.No.: IGIP-5887HF
• Product Overview: Human LOC492311 full-length ORF (AAH17422.2, 1 a.a. - 53 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 53 amino acids
• Description: IGIP (IgA Inducing Protein) is a Protein Coding gene.
• Molecular Mass: 32.23 kDa
• AA Sequence: MCSYYHMKKRSVSGCNITIFAVMFSHLSAGKSPCGNQANVLCISRLEFVQYQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IGIP IgA inducing protein [ Homo sapiens (human) ]
• Official Symbol: IGIP
• Synonyms: IGIP; IgA inducing protein; C5orf53; IgA-inducing protein homolog; IgA-inducing protein homolog (Bos taurus)
• Gene ID: 492311
• mRNA Refseq: NM_001007189
• Protein Refseq: NP_001007190
• UniProt ID: A6NJ69