Recombinant Full Length Human IFFO1 Protein, GST-tagged

• Cat.No.: IFFO1-3694HF
• Product Overview: Human HOM-TES-103 full-length ORF ( NP_542769.2, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 200 amino acids
• Description: This gene is a member of the intermediate filament family. Intermediate filaments are proteins which are primordial components of the cytoskeleton and nuclear envelope. The proteins encoded by the members of this gene family are evolutionarily and structurally related but have limited sequence homology, with the exception of the central rod domain. Alternative splicing has been observed for this gene and three transcript variants encoding different isoforms have been identified. Other alternatively spliced transcripts may exist, but their biological validity has not been confirmed. [provided by RefSeq
• Molecular Mass: 49.3 kDa
• AA Sequence: MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IFFO1 intermediate filament family orphan 1 [ Homo sapiens ]
• Official Symbol: IFFO1
• Synonyms: IFFO1; intermediate filament family orphan 1; IFFO, intermediate filament family orphan; HOM TES 103; intermediate filament-like MGC:2625; IFFO; HOM-TES-103; FLJ20703; MGC117359; DKFZp586I2223
• Gene ID: 25900
• mRNA Refseq: NM_001039670
• Protein Refseq: NP_001034759
• MIM: 610495
• UniProt ID: Q0D2I5