Recombinant Full Length Human IDH2 Protein, C-Flag-tagged
Cat.No. : | IDH2-1044HFL |
Product Overview : | Recombinant Full Length Human IDH2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.6 kDa |
AA Sequence : | MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKL ILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIR NILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVY NFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDK NKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Citrate cycle (TCA cycle), Glutathione metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | IDH2 isocitrate dehydrogenase (NADP(+)) 2 [ Homo sapiens (human) ] |
Official Symbol | IDH2 |
Synonyms | IDH; IDP; IDHM; IDPM; ICD-M; IDH-2; D2HGA2; mNADP-IDH |
Gene ID | 3418 |
mRNA Refseq | NM_002168.4 |
Protein Refseq | NP_002159.2 |
MIM | 147650 |
UniProt ID | P48735 |
◆ Recombinant Proteins | ||
IDH2-4410M | Recombinant Mouse IDH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IDH2-116H | Recombinant Human IDH2(R140Q) Protein, His-tagged | +Inquiry |
IDH2-2986R | Recombinant Rat IDH2 Protein | +Inquiry |
IDH2-14048H | Recombinant Human IDH2, GST-tagged | +Inquiry |
IDH2-7985M | Recombinant Mouse IDH2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IDH2-5306HCL | Recombinant Human IDH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IDH2 Products
Required fields are marked with *
My Review for All IDH2 Products
Required fields are marked with *
0
Inquiry Basket