Recombinant Full Length Human IDH1 Protein, C-Flag-tagged
Cat.No. : | IDH1-1116HFL |
Product Overview : | Recombinant Full Length Human IDH1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.5 kDa |
AA Sequence : | MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVG VKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYR ATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLS TKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDS VAQGYGSLGMMTSVLVCPDGKTVEAESAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNK ELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Citrate cycle (TCA cycle), Glutathione metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | IDH1 isocitrate dehydrogenase (NADP(+)) 1 [ Homo sapiens (human) ] |
Official Symbol | IDH1 |
Synonyms | IDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26 |
Gene ID | 3417 |
mRNA Refseq | NM_005896.4 |
Protein Refseq | NP_005887.2 |
MIM | 147700 |
UniProt ID | O75874 |
◆ Recombinant Proteins | ||
IDH1-1284H | Recombinant Human Isocitrate Dehydrogenase 1 (NADP+), Soluble, His-tagged | +Inquiry |
Idh1-1583M | Recombinant Mouse Idh1 protein, His & GST-tagged | +Inquiry |
IDH1-4409M | Recombinant Mouse IDH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IDH1-111H | Recombinant Human IDH1(R132C) Protein, His-tagged | +Inquiry |
IDH1-1134H | Recombinant Human IDH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IDH1-5307HCL | Recombinant Human IDH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IDH1 Products
Required fields are marked with *
My Review for All IDH1 Products
Required fields are marked with *
0
Inquiry Basket