Recombinant Full Length Human HSPE1 Protein, GST-tagged

• Cat.No.: HSPE1-5653HF
• Product Overview: Human HSPE1 full-length ORF ( AAH23518, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 102 amino acids
• Description: This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. [provided by RefSeq
• Molecular Mass: 36.96 kDa
• AA Sequence: MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSPE1 heat shock 10kDa protein 1 (chaperonin 10) [ Homo sapiens ]
• Official Symbol: HSPE1
• Synonyms: HSPE1; heat shock 10kDa protein 1 (chaperonin 10); heat shock 10kD protein 1 (chaperonin 10); 10 kDa heat shock protein, mitochondrial; CPN10; GROES; chaperonin 10; 10 kDa chaperonin; early-pregnancy factor; EPF; HSP10
• Gene ID: 3336
• mRNA Refseq: NM_002157
• Protein Refseq: NP_002148
• MIM: 600141
• UniProt ID: P61604