Recombinant Full Length Human HSPBP1 Protein, GST-tagged

• Cat.No.: HSPBP1-3972HF
• Product Overview: Human HSPBP1 full-length ORF ( NP_036399.3, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HSPBP1 (HSPA (Hsp70) Binding Protein 1) is a Protein Coding gene. Among its related pathways are Mechanisms of CFTR activation by S-nitrosoglutathione (normal and CF) and Protein processing in endoplasmic reticulum. GO annotations related to this gene include binding and enzyme inhibitor activity.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 65.7 kDa
• Protein length: 359 amino acids
• AA Sequence: MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSPBP1 HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1 [ Homo sapiens ]
• Official Symbol: HSPBP1
• Synonyms: HSPBP1; HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1; hsp70-binding protein 1; FES1; Hsp70 binding protein 1; hsp70 interacting protein; HspBP1; hspBP2; hsp70-binding protein 2; hsp70-interacting protein 1; hsp70-interacting protein 2; heat shock protein-binding protein 1
• Gene ID: 23640
• mRNA Refseq: NM_001130106
• Protein Refseq: NP_001123578
• MIM: 612939
• UniProt ID: Q9NZL4