Recombinant Full Length Human HSPBP1 Protein, GST-tagged
Cat.No. : | HSPBP1-3972HF |
Product Overview : | Human HSPBP1 full-length ORF ( NP_036399.3, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 359 amino acids |
Description : | HSPBP1 (HSPA (Hsp70) Binding Protein 1) is a Protein Coding gene. Among its related pathways are Mechanisms of CFTR activation by S-nitrosoglutathione (normal and CF) and Protein processing in endoplasmic reticulum. GO annotations related to this gene include binding and enzyme inhibitor activity. |
Molecular Mass : | 65.7 kDa |
AA Sequence : | MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSPBP1 HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1 [ Homo sapiens ] |
Official Symbol | HSPBP1 |
Synonyms | HSPBP1; HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1; hsp70-binding protein 1; FES1; Hsp70 binding protein 1; hsp70 interacting protein; HspBP1; hspBP2; hsp70-binding protein 2; hsp70-interacting protein 1; hsp70-interacting protein 2; heat shock protein-binding protein 1; |
Gene ID | 23640 |
mRNA Refseq | NM_001130106 |
Protein Refseq | NP_001123578 |
MIM | 612939 |
UniProt ID | Q9NZL4 |
◆ Recombinant Proteins | ||
HSPBP1-4368M | Recombinant Mouse HSPBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSPBP1-2611R | Recombinant Rat HSPBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSPBP1-8061H | Recombinant Human HSPBP1 protein, His & GST-tagged | +Inquiry |
HSPBP1-3972HF | Recombinant Full Length Human HSPBP1 Protein, GST-tagged | +Inquiry |
HSPBP1-2733H | Recombinant Human HSPBP1 Protein (Asn133-Ser351), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPBP1-5342HCL | Recombinant Human HSPBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSPBP1 Products
Required fields are marked with *
My Review for All HSPBP1 Products
Required fields are marked with *
0
Inquiry Basket