Recombinant Full Length Human HSPB9 Protein, GST-tagged

• Cat.No.: HSPB9-3970HF
• Product Overview: Human HSPB9 full-length ORF ( NP_149971.1, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HSPB9 (Heat Shock Protein Family B (Small) Member 9) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 43.9 kDa
• Protein length: 159 amino acids
• AA Sequence: MQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSPB9 heat shock protein, alpha-crystallin-related, B9 [ Homo sapiens ]
• Official Symbol: HSPB9
• Synonyms: HSPB9; heat shock protein, alpha-crystallin-related, B9; heat shock protein beta-9; cancer/testis antigen 51; CT51; small heat shock protein B9; FLJ27437
• Gene ID: 94086
• mRNA Refseq: NM_033194
• Protein Refseq: NP_149971
• MIM: 608344
• UniProt ID: Q9BQS6