Recombinant Full Length Human HSPB9 Protein, GST-tagged
Cat.No. : | HSPB9-3970HF |
Product Overview : | Human HSPB9 full-length ORF ( NP_149971.1, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | HSPB9 (Heat Shock Protein Family B (Small) Member 9) is a Protein Coding gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 43.9 kDa |
Protein length : | 159 amino acids |
AA Sequence : | MQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSPB9 heat shock protein, alpha-crystallin-related, B9 [ Homo sapiens ] |
Official Symbol | HSPB9 |
Synonyms | HSPB9; heat shock protein, alpha-crystallin-related, B9; heat shock protein beta-9; cancer/testis antigen 51; CT51; small heat shock protein B9; FLJ27437; |
Gene ID | 94086 |
mRNA Refseq | NM_033194 |
Protein Refseq | NP_149971 |
MIM | 608344 |
UniProt ID | Q9BQS6 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HSPB9 Products
Required fields are marked with *
My Review for All HSPB9 Products
Required fields are marked with *
0
Inquiry Basket