Recombinant Full Length Human HSFX1 Protein, GST-tagged

• Cat.No.: HSFX1-6223HF
• Product Overview: Human LW-1 full-length ORF ( AAH21706, 1 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HSFX1 (Heat Shock Transcription Factor Family, X-Linked 1) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is HSFX2.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 72.27 kDa
• Protein length: 423 amino acids
• AA Sequence: MEDKRSLSMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSNQFSSIWWDDSGACRVINQKLFEKEILKRDVAHKVFATTSIKSFFRQLNLYGFRKRRQCTFRTFTRIFSAKRLVSILNKLEFYCHPYFQRDSPHLLVRMKRRVGVKSAPRHQEEDKPEAAGSCLAPADTEQQDHTSPNENDQVTPQHREPAGPNTQIRSGSAPPATPVMVPDSAVASDNSPVTQPAGEWSEGSQAHVTPVAAVPGPAALPFLYVPGSPTQMNSYGPVVALPTASRSTLAMDTTGLPAPGMLPFCHLWVPVTLVAAGAAQPAASMVMFPHLPALHHHCPHSHRTSQYMPASDGPQAYPDYADQST
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSFX1 heat shock transcription factor family, X linked 1 [ Homo sapiens ]
• Official Symbol: HSFX1
• Synonyms: HSFX1; heat shock transcription factor family, X linked 1; heat shock transcription factor, X-linked; LW 1; LW-1; HSFX2; FLJ17347; MGC26102
• Gene ID: 100506164
• mRNA Refseq: NM_016153
• Protein Refseq: NP_057237
• UniProt ID: Q9UBD0