Recombinant Full Length Human HSF2 Protein, GST-tagged

• Cat.No.: HSF2-3888HF
• Product Overview: Human HSF2 full-length ORF ( AAH05329, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HSF2, as well as the related gene HSF1, encodes a protein that binds specifically to the heat-shock element and has homology to HSFs of other species. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Although the names HSF1 and HSF2 were chosen for historical reasons, these peptides should be referred to as heat-shock transcription factors. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 51.04 kDa
• Protein length: 230 amino acids
• AA Sequence: MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSF2 heat shock transcription factor 2 [ Homo sapiens ]
• Official Symbol: HSF2
• Synonyms: HSF2; heat shock transcription factor 2; heat shock factor protein 2; HSF 2; HSTF 2; MGC75048; MGC117376; MGC156196
• Gene ID: 3298
• mRNA Refseq: NM_001135564
• Protein Refseq: NP_001129036
• MIM: 140581
• UniProt ID: Q03933