Recombinant Full Length Human HSDL2 Protein, GST-tagged

• Cat.No.: HSDL2-3886HF
• Product Overview: Human HSDL2 full-length ORF ( NP_115679.2, 1 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 418 amino acids
• Description: HSDL2 (Hydroxysteroid Dehydrogenase Like 2) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity.
• Molecular Mass: 71.8 kDa
• AA Sequence: MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALPCIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEAVSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLKSKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSDL2 hydroxysteroid dehydrogenase like 2 [ Homo sapiens ]
• Official Symbol: HSDL2
• Synonyms: HSDL2; hydroxysteroid dehydrogenase like 2; C9orf99, chromosome 9 open reading frame 99; hydroxysteroid dehydrogenase-like protein 2; SDR13C1; short chain dehydrogenase/reductase family 13C; member 1; short chain dehydrogenase/reductase family 13C, member 1; C9orf99; FLJ25855; MGC10940
• Gene ID: 84263
• mRNA Refseq: NM_001195822
• Protein Refseq: NP_001182751
• UniProt ID: Q6YN16