Recombinant Full Length Human HSDL2 Protein, GST-tagged

Cat.No. : HSDL2-3886HF
Product Overview : Human HSDL2 full-length ORF ( NP_115679.2, 1 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 418 amino acids
Description : HSDL2 (Hydroxysteroid Dehydrogenase Like 2) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity.
Molecular Mass : 71.8 kDa
AA Sequence : MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALPCIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEAVSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLKSKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSDL2 hydroxysteroid dehydrogenase like 2 [ Homo sapiens ]
Official Symbol HSDL2
Synonyms HSDL2; hydroxysteroid dehydrogenase like 2; C9orf99, chromosome 9 open reading frame 99; hydroxysteroid dehydrogenase-like protein 2; SDR13C1; short chain dehydrogenase/reductase family 13C; member 1; short chain dehydrogenase/reductase family 13C, member 1; C9orf99; FLJ25855; MGC10940;
Gene ID 84263
mRNA Refseq NM_001195822
Protein Refseq NP_001182751
UniProt ID Q6YN16

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HSDL2 Products

Required fields are marked with *

My Review for All HSDL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon