Recombinant Full Length Human HSDL2 Protein, C-Flag-tagged
Cat.No. : | HSDL2-1485HFL |
Product Overview : | Recombinant Full Length Human HSDL2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable oxidoreductase activity. Located in mitochondrion and peroxisome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.2 kDa |
AA Sequence : | MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALP CIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYL KKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLG GPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEA VSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLK SKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | HSDL2 hydroxysteroid dehydrogenase like 2 [ Homo sapiens (human) ] |
Official Symbol | HSDL2 |
Synonyms | C9orf99; SDR13C1 |
Gene ID | 84263 |
mRNA Refseq | NM_032303.5 |
Protein Refseq | NP_115679.2 |
UniProt ID | Q6YN16 |
◆ Recombinant Proteins | ||
SLC7A8-4130R | Recombinant Rhesus Macaque SLC7A8 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNH1-4521H | Recombinant Human RNH1 protein, His&Myc-tagged | +Inquiry |
RFL32985OF | Recombinant Full Length Oryza Sativa Subsp. Japonica Potassium Channel Kat4(Os06G0254200, Loc_Os06G14310) Protein, His-Tagged | +Inquiry |
TNFSF13B-3282H | Recombinant Human TNFSF13B protein, His-tagged | +Inquiry |
LRRTM1-3144R | Recombinant Rat LRRTM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CTRC-27191TH | Native Human CTRC | +Inquiry |
MMP9-39H | Native Human MMP-9/Lipocalin Complex | +Inquiry |
Lectin-1771D | Active Native Dolichos Biflorus Lectin Protein | +Inquiry |
F2-303R | Native Rat Thrombin | +Inquiry |
Endoproteinase Lys-C-85L | Native Lysobacter enzymogenes Endoproteinase Lys-C | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD68-001HCL | Recombinant Human CD68 cell lysate | +Inquiry |
RGS9-2367HCL | Recombinant Human RGS9 293 Cell Lysate | +Inquiry |
PGF-1118MCL | Recombinant Mouse PGF cell lysate | +Inquiry |
MAGEA6-4551HCL | Recombinant Human MAGEA6 293 Cell Lysate | +Inquiry |
VOPP1-399HCL | Recombinant Human VOPP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSDL2 Products
Required fields are marked with *
My Review for All HSDL2 Products
Required fields are marked with *
0
Inquiry Basket