Recombinant Full Length Human HSD17B7 Protein, C-Flag-tagged

Cat.No. : HSD17B7-1470HFL
Product Overview : Recombinant Full Length Human HSD17B7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : HSD17B7 encodes an enzyme that functions both as a 17-beta-hydroxysteroid dehydrogenase (EC 1.1.1.62) in the biosynthesis of sex steroids and as a 3-ketosteroid reductase (EC 1.1.1.270) in the biosynthesis of cholesterol.
Source : Mammalian cells
Species : Human
Tag : Flag
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 38 kDa
AA Sequence : MRKVVLITGASSGIGLALCKRLLAEDDELHLCLACRNMSKAEAVCAALLASHPTAEVTIVQVDVSNLQSV FRASKELKQRFQRLDCIYLNAGIMPNPQLNIKALFFGLFSRKVIHMFSTAEGLLTQGDKITADGLQEVFE TNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSARKSNFSLEDFQHSKGKEPYSSSKYATDLLSVALNRN FNQQGLYSNVACPGTALTNLTYGILPPFIWTLLMPAILLLRFFANAFTLTPYNGTEALVWLFHQKPESLN
PLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Androgen and estrogen metabolism, Metabolic pathways, Steroid biosynthesis
Full Length : Full L.
Gene Name HSD17B7 hydroxysteroid 17-beta dehydrogenase 7 [ Homo sapiens (human) ]
Official Symbol HSD17B7
Synonyms PRAP; SDR37C1
Gene ID 51478
mRNA Refseq NM_016371.4
Protein Refseq NP_057455.1
MIM 606756
UniProt ID P56937

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HSD17B7 Products

Required fields are marked with *

My Review for All HSD17B7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon