Recombinant Full Length Human HSD17B2 Protein, GST-tagged

Cat.No. : HSD17B2-6951HF
Product Overview : Recombinant Human full-length HSD17B2(1 a.a. - 387 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 387 amino acids
Description : Estradiol 17-beta-dehydrogenase 2 is an enzyme that in humans is encoded by the HSD17B2 gene.
Molecular Mass : 68.31 kDa
AA Sequence : MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQ ELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYS KVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAP MERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPR ALRMPNYKKKAT
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSD17B2 hydroxysteroid (17-beta) dehydrogenase 2 [ Homo sapiens (human) ]
Official Symbol HSD17B2
Synonyms HSD17B2; hydroxysteroid (17-beta) dehydrogenase 2; estradiol 17-beta-dehydrogenase 2; HSD17; SDR9C2; short chain dehydrogenase/reductase family 9C; member 2; 17 beta HSD 2; 20 alpha HSD; 20 alpha hydroxysteroid dehydrogenase; E2DH; Microsomal 17 beta hydroxysteroid dehydrogenase; Testosterone 17 beta dehydrogenase; E2DH; 20-alpha-HSD; 17-beta-HSD 2; OTTHUMP00000174979; testosterone 17-beta-dehydrogenase; 20 alpha-hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase type 2; microsomal 17-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 9C, member 2; EDH17B2
Gene ID 3294
mRNA Refseq NM_002153
Protein Refseq NP_002144
MIM 109685
UniProt ID P37059

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HSD17B2 Products

Required fields are marked with *

My Review for All HSD17B2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon