Recombinant Full Length Human HS3ST1 Protein, GST-tagged

• Cat.No.: HS3ST1-3693HF
• Product Overview: Human HS3ST1 full-length ORF ( NP_005105.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 307 amino acids
• Description: Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein. [provided by RefSeq
• Molecular Mass: 62.2 kDa
• AA Sequence: MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HS3ST1 heparan sulfate (glucosamine) 3-O-sulfotransferase 1 [ Homo sapiens ]
• Official Symbol: HS3ST1
• Synonyms: HS3ST1; heparan sulfate (glucosamine) 3-O-sulfotransferase 1; heparan sulfate glucosamine 3-O-sulfotransferase 1; 3OST1; 3-OST-1; h3-OST-1; heparan sulfate 3-O-sulfotransferase 1; heparin-glucosamine 3-O-sulfotransferase; heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1; 3OST
• Gene ID: 9957
• mRNA Refseq: NM_005114
• Protein Refseq: NP_005105
• MIM: 603244
• UniProt ID: O14792