Recombinant Full Length Human HRASLS Protein, GST-tagged

• Cat.No.: HRASLS-3651HF
• Product Overview: Human HRASLS full-length ORF ( NP_065119.1, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HRASLS (HRAS Like Suppressor) is a Protein Coding gene. Among its related pathways are Acyl chain remodelling of PE and Glycerophospholipid biosynthesis. GO annotations related to this gene include hydrolase activity and phospholipase activity. An important paralog of this gene is RARRES3.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 45.2 kDa
• Protein length: 168 amino acids
• AA Sequence: MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVFSSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANRAISTVEFVTAAVGVFSFLGLFPKGQRAKYY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HRASLS HRAS-like suppressor [ Homo sapiens ]
• Official Symbol: HRASLS
• Synonyms: HRASLS; HRAS-like suppressor; H REV107; HRASLS1; phospholipase A; H-REV107 protein-related protein; A-C1; HSD28; H-REV107
• Gene ID: 57110
• mRNA Refseq: NM_020386
• Protein Refseq: NP_065119
• MIM: 606487
• UniProt ID: Q9HDD0