Recombinant Full Length Human HPR Protein, C-Flag-tagged
Cat.No. : | HPR-509HFL |
Product Overview : | Recombinant Full Length Human HPR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a haptoglobin-related protein that binds hemoglobin as efficiently as haptoglobin. Unlike haptoglobin, plasma concentration of this protein is unaffected in patients with sickle cell anemia and extensive intravascular hemolysis, suggesting a difference in binding between haptoglobin-hemoglobin and haptoglobin-related protein-hemoglobin complexes to CD163, the hemoglobin scavenger receptor. This protein may also be a clinically important predictor of recurrence of breast cancer. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.8 kDa |
AA Sequence : | MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLN DKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLL TTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLP SKNYAEVGRVGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHT FCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAENTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease, Secreted Protein |
Full Length : | Full L. |
Gene Name | HPR haptoglobin-related protein [ Homo sapiens (human) ] |
Official Symbol | HPR |
Synonyms | HP; A-259H10.2 |
Gene ID | 3250 |
mRNA Refseq | NM_020995.4 |
Protein Refseq | NP_066275.3 |
MIM | 140210 |
UniProt ID | P00739 |
◆ Recombinant Proteins | ||
HPR-0053B | Recombinant Bacillus subtilis HPR protein, His-tagged | +Inquiry |
HPR-2092H | Recombinant Human HPR protein, His & T7-tagged | +Inquiry |
HPR-509HFL | Recombinant Full Length Human HPR Protein, C-Flag-tagged | +Inquiry |
HPR-5085H | Recombinant Human HPR, His-tagged | +Inquiry |
HPR-1095H | Recombinant Human HPR Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HPR Products
Required fields are marked with *
My Review for All HPR Products
Required fields are marked with *
0
Inquiry Basket