Recombinant Full Length Human HPGD Protein, GST-tagged

• Cat.No.: HPGD-3624HF
• Product Overview: Human HPGD full-length ORF ( AAH18986, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 55.00 kDa
• Protein length: 266 amino acids
• AA Sequence: MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HPGD hydroxyprostaglandin dehydrogenase 15-(NAD) [ Homo sapiens ]
• Official Symbol: HPGD
• Synonyms: HPGD; hydroxyprostaglandin dehydrogenase 15-(NAD); 15-hydroxyprostaglandin dehydrogenase [NAD(+)]; SDR36C1; short chain dehydrogenase/reductase family 36C; member 1; prostaglandin dehydrogenase 1; NAD+-dependent 15-hydroxyprostaglandin dehydrogenase; short chain dehydrogenase/reductase family 36C, member 1; PGDH; PGDH1; PHOAR1; 15-PGDH
• Gene ID: 3248
• mRNA Refseq: NM_000860
• Protein Refseq: NP_000851
• MIM: 601688
• UniProt ID: P15428