Recombinant Full Length Human HPDL Protein, C-Flag-tagged

• Cat.No.: HPDL-854HFL
• Product Overview: Recombinant Full Length Human HPDL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: The protein encoded by this intronless gene localizes to mitochondria, where it may function as 4-hydroxyphenylpyruvate dioxygenase. Clinical studies have identified several bi-allelic variants in this gene that lower the level of the encoded protein and lead to a clinically variable form of pediatric-onset spastic movement disorder.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 39.2 kDa
• AA Sequence: MAAPALRLCHIAFHVPAGQPLARNLQRLFGFQPLASREVDGWRQLALRSGDAVFLVNEGAGSGEPLYGLD PRHAVPSATNLCFDVADAGAATRELAALGCSVPVPPVRVRDAQGAATYAVVSSPAGILSLTLLERAGYRG PFLPGFRPVSSAPGPGWVSRVDHLTLACTPGSSPTLLRWFHDCLGFCHLPLSPGEDPELGLEMTAGFGLG GLRLTALQAQPGSIVPTLVLAESLPGATTRQDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQF LAPPGAYYQQPGKERQIRAAGHEPHLLARQGILLDGDKGKFLLQVFTKSLFTEDTFFLELIQRQGATGFG
  QGNIRALWQSVQEQSARSQEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: HPDL 4-hydroxyphenylpyruvate dioxygenase like [ Homo sapiens (human) ]
• Official Symbol: HPDL
• Synonyms: SPG83; GLOXD1; NEDSWMA; 4-HPPD-L
• Gene ID: 84842
• mRNA Refseq: NM_032756.4
• Protein Refseq: NP_116145.1
• MIM: 618994
• UniProt ID: Q96IR7