Recombinant Full Length Human HOXC9 Protein, GST-tagged
Cat.No. : | HOXC9-3730HF |
Product Overview : | Human HOXC9 full-length ORF ( AAH53894, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 260 amino acids |
Description : | This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. [provided by RefSeq |
Molecular Mass : | 54.34 kDa |
AA Sequence : | MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVPSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXC9 homeobox C9 [ Homo sapiens ] |
Official Symbol | HOXC9 |
Synonyms | HOXC9; homeobox C9; homeo box C9 , HOX3, HOX3B; homeobox protein Hox-C9; homeo box C9; homeobox protein Hox-3B; HOX3; HOX3B; |
Gene ID | 3225 |
mRNA Refseq | NM_006897 |
Protein Refseq | NP_008828 |
MIM | 142971 |
UniProt ID | P31274 |
◆ Recombinant Proteins | ||
HOXC9-4758C | Recombinant Chicken HOXC9 | +Inquiry |
HOXC9-4987H | Recombinant Human HOXC9 Protein, GST-tagged | +Inquiry |
HOXC9-1892H | Recombinant Human HOXC9 Protein, MYC/DDK-tagged | +Inquiry |
HOXC9-7812M | Recombinant Mouse HOXC9 Protein | +Inquiry |
HOXC9-3730HF | Recombinant Full Length Human HOXC9 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXC9 Products
Required fields are marked with *
My Review for All HOXC9 Products
Required fields are marked with *
0
Inquiry Basket