Recombinant Full Length Human HOXA7 Protein, GST-tagged

• Cat.No.: HOXA7-3713HF
• Product Overview: Human HOXA7 full-length ORF ( NP_008827.2, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 230 amino acids
• Description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. For example, the encoded protein represses the transcription of differentiation-specific genes during keratinocyte proliferation, but this repression is then overcome by differentiation signals. This gene is highly similar to the antennapedia (Antp) gene of Drosophila. [provided by RefSeq
• Molecular Mass: 51.8 kDa
• AA Sequence: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDEEEEDEEE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HOXA7 homeobox A7 [ Homo sapiens ]
• Official Symbol: HOXA7
• Synonyms: HOXA7; homeobox A7; homeo box A7 , HOX1, HOX1A; homeobox protein Hox-A7; homeo box A7; homeobox protein HOX-1A; homeobox protein Hox 1.1; ANTP; HOX1; HOX1A; HOX1.1
• Gene ID: 3204
• mRNA Refseq: NM_006896
• Protein Refseq: NP_008827
• MIM: 142950
• UniProt ID: P31268