Recombinant Full Length Human HMGN3 Protein, GST-tagged

• Cat.No.: HMGN3-3661HF
• Product Overview: Human HMGN3 full-length ORF ( AAH09529, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 77 amino acids
• Description: Thyroid hormone receptors are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. The protein encoded by this gene binds thyroid hormone receptor beta, but only in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 34.21 kDa
• AA Sequence: MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HMGN3 high mobility group nucleosomal binding domain 3 [ Homo sapiens ]
• Official Symbol: HMGN3
• Synonyms: HMGN3; high mobility group nucleosomal binding domain 3; thyroid hormone receptor interactor 7 , TRIP7; high mobility group nucleosome-binding domain-containing protein 3; TR-interacting protein 7; thyroid hormone receptor interacting protein 7; TRIP7; PNAS-24; PNAS-25; FLJ42187; DKFZp686E20226
• Gene ID: 9324
• mRNA Refseq: NM_001201362
• Protein Refseq: NP_001188291
• MIM: 604502
• UniProt ID: Q15651