Recombinant Full Length Human HMGN2 Protein, GST-tagged

• Cat.No.: HMGN2-3659HF
• Product Overview: Human HMGN2 full-length ORF ( AAH14644, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 90 amino acids
• Description: The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMGN1, the encoded protein may help maintain an open chromatin configuration around transcribable genes. The protein has also been found to have antimicrobial activity against bacteria, viruses and fungi. [provided by RefSeq, Oct 2014]
• Molecular Mass: 35.64 kDa
• AA Sequence: MPKRKAEEDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HMGN2 high mobility group nucleosomal binding domain 2 [ Homo sapiens ]
• Official Symbol: HMGN2
• Synonyms: HMG17
• Gene ID: 3151
• mRNA Refseq: NM_005517
• Protein Refseq: NP_005508
• MIM: 163910
• UniProt ID: P05204