Recombinant Full Length Human HMBS Protein
Cat.No. : | HMBS-237HF |
Product Overview : | Recombinant full length Human HMBS with a proprietary N terminal tag. Predicted MW 65.82kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 361 amino acids |
Description : | This gene encodes a member of the hydroxymethylbilane synthase superfamily. The encoded protein is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria. Alternatively spliced transcript variants encoding different isoforms have been described. |
Form : | Liquid |
Molecular Mass : | 65.820kDa inclusive of tags |
AA Sequence : | MSGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVA TLKASYPGLQFEIIAMSTTGDKIPDTALSKIGEKSLFTKE LEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPH DAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPH LEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHN RVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHD PETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTG GVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITA RNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQLNDA H |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | HMBS hydroxymethylbilane synthase [ Homo sapiens ] |
Official Symbol | HMBS |
Synonyms | HMBS; hydroxymethylbilane synthase; PBGD, PORC, porphobilinogen deaminase , porphyria, acute; Chester type , UPS, uroporphyrinogen I synthase; porphobilinogen deaminase |
Gene ID | 3145 |
mRNA Refseq | NM_000190 |
Protein Refseq | NP_000181 |
MIM | 609806 |
UniProt ID | P08397 |
◆ Recombinant Proteins | ||
HMBS-13835H | Recombinant Human HMBS, GST-tagged | +Inquiry |
HMBS-2031H | Recombinant Human HMBS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HMBS-4856H | Recombinant Human HMBS Protein, GST-tagged | +Inquiry |
HMBS-2105R | Recombinant Rhesus monkey HMBS Protein, His-tagged | +Inquiry |
HMBS-1926R | Recombinant Rhesus Macaque HMBS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMBS-5484HCL | Recombinant Human HMBS 293 Cell Lysate | +Inquiry |
HMBS-5483HCL | Recombinant Human HMBS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMBS Products
Required fields are marked with *
My Review for All HMBS Products
Required fields are marked with *
0
Inquiry Basket