Recombinant Full Length Human HM13 Protein, GST-tagged

• Cat.No.: HM13-3635HF
• Product Overview: Human HM13 full-length ORF ( NP_848697.1, 1 a.a. - 143 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene, which localizes to the endoplasmic reticulum, catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein. This activity is required to generate signal sequence-derived human lymphocyte antigen-E epitopes that are recognized by the immune system, and to process hepatitis C virus core protein. The encoded protein is an integral membrane protein with sequence motifs characteristic of the presenilin-type aspartic proteases. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 41.80 kDa
• Protein length: 143 amino acids
• AA Sequence: MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARGKNASDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTIRSEGISLQHLKQLSREPVQGLG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HM13 histocompatibility (minor) 13 [ Homo sapiens ]
• Official Symbol: HM13
• Synonyms: HM13; histocompatibility (minor) 13; minor histocompatibility antigen H13; dJ324O17.1; H13; IMP1; IMPAS; intramembrane protease; presenilin like protein 3; PSENL3; PSL3; signal peptide peptidase beta; signal peptide peptidase like 1; SPP; SPPL1; IMP-1; hIMP1; intramembrane protease 1; presenilin-like protein 3; minor histocompatibility antigen 13; IMPAS-1; MSTP086
• Gene ID: 81502
• mRNA Refseq: NM_030789
• Protein Refseq: NP_110416
• MIM: 607106
• UniProt ID: Q8TCT9