Recombinant Full Length Human HLA-V Protein, GST-tagged

• Cat.No.: HLA-V-5905HF
• Product Overview: Human LOC554223 full-length ORF ( AAH51362.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 189 amino acids
• Description: HLA-V (Major Histocompatibility Complex, Class I, V (Pseudogene)) is a Pseudogene.
• Molecular Mass: 47.3 kDa
• AA Sequence: MDWGGPALGIPHLCRVSLLPLPTCVGSFFLGTHRAAPVLTPIECRVSREANQCSRGPGSKVPTHPPGLRFFPVAEDGVMAPRTLLLLLSGALVLTQTWAGFHSLRYFHTTMSRPGRADPRFLSVGDVDDTQCVRLDSDATSPRMEPRAPWMEQEGPEYWEEETGTAKAKAQFYRVNLRTLSGYYNQSEA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HLA-V major histocompatibility complex, class I, V (pseudogene) [ Homo sapiens (human) ]
• Official Symbol: HLA-V
• Synonyms: HLA-V; major histocompatibility complex, class I, V (pseudogene); HLA-75; dJ377H14.4; FLJ17298; FLJ46428; MGC59962; HLA-75 pseudogene; histocompatibility antigen-related
• Gene ID: 352962