Recombinant Full Length Human HIST3H2A Protein, GST-tagged

• Cat.No.: HIST3H2A-3604HF
• Product Overview: Human HIST3H2A full-length ORF (BAG34871.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 130 amino acids
• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq
• Molecular Mass: 40.7 kDa
• AA Sequence: MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIST3H2A histone cluster 3 H2A [ Homo sapiens (human) ]
• Official Symbol: HIST3H2A
• Synonyms: HIST3H2A; histone cluster 3 H2A; histone H2A type 3; histone 3, H2a; histone cluster 3, H2a
• Gene ID: 92815
• mRNA Refseq: NM_033445
• Protein Refseq: NP_254280
• MIM: 615015
• UniProt ID: Q7L7L0