Recombinant Full Length Human HIST2H2AA3 Protein, GST-tagged
Cat.No. : | HIST2H2AA3-3596HF |
Product Overview : | Human HIST2H2AA full-length ORF ( AAH01629, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 130 amino acids |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy. [provided by RefSeq |
Molecular Mass : | 40.04 kDa |
AA Sequence : | MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIST2H2AA3 histone cluster 2, H2aa3 [ Homo sapiens ] |
Official Symbol | HIST2H2AA3 |
Synonyms | HIST2H2AA3; histone cluster 2, H2aa3; H2A histone family, member O , H2AFO, HIST2H2AA, histone 2, H2aa , histone 2, H2aa3; histone H2A type 2-A; H2A.2; H2A/q; histone H2A.2; histone H2A/o; histone 2, H2aa3; H2A histone family, member O; H2A; H2A/O; H2AFO; H2a-615; HIST2H2AA; |
Gene ID | 8337 |
mRNA Refseq | NM_003516 |
Protein Refseq | NP_003507 |
MIM | 142720 |
UniProt ID | Q6FI13 |
◆ Recombinant Proteins | ||
HIST2H2AA3-3596HF | Recombinant Full Length Human HIST2H2AA3 Protein, GST-tagged | +Inquiry |
HIST2H2AA3-1515H | Recombinant Human HIST2H2AA3 protein, His & GST-tagged | +Inquiry |
HIST2H2AA3-4808H | Recombinant Human HIST2H2AA3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIST2H2AA3 Products
Required fields are marked with *
My Review for All HIST2H2AA3 Products
Required fields are marked with *
0
Inquiry Basket