Recombinant Full Length Human HIST1H4K Protein, GST-tagged

Cat.No. : HIST1H4K-3595HF
Product Overview : Human HIST1H4K full-length ORF ( AAI53082.1, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the small histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 38.28 kDa
Protein length : 103 amino acids
AA Sequence : MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIST1H4K histone cluster 1 H4 family member k [ Homo sapiens (human) ]
Official Symbol HIST1H4K
Synonyms HIST1H4K; histone cluster 1 H4 family member k; H4/d; H4FD; H4F2iii; dJ160A22.1; histone H4; H4 histone family, member D; histone 1, H4k; histone cluster 1, H4k
Gene ID 8362
mRNA Refseq NM_003541
Protein Refseq NP_003532
MIM 602825
UniProt ID P62805

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HIST1H4K Products

Required fields are marked with *

My Review for All HIST1H4K Products

Required fields are marked with *

0

Inquiry Basket

cartIcon