Recombinant Full Length Human HIST1H3F Protein, GST-tagged

• Cat.No.: HIST1H3F-3589HF
• Product Overview: Human HIST1H3F full-length ORF (ADR82713.1, 1 a.a. - 136 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 41.4 kDa
• Protein length: 136 amino acids
• AA Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIST1H3F histone cluster 1 H3 family member f [ Homo sapiens (human) ]
• Official Symbol: HIST1H3F
• Synonyms: HIST1H3F; histone cluster 1 H3 family member f; H3/i; H3FI; histone H3.1; H3 histone family, member I; histone 1, H3f; histone H3/I; histone cluster 1, H3f
• Gene ID: 8968
• mRNA Refseq: NM_021018
• Protein Refseq: NP_066298
• MIM: 602816
• UniProt ID: P68431